Difference between revisions of "HFE"

From Genetics Wiki
Jump to: navigation, search
Line 1: Line 1:
HFE is named after '''H'''igh '''Fe''' (iron).  The protein has a signal sequence and transmembrane domain.   
+
''HFE'' is named after '''H'''igh '''Fe''' (iron).  The gene products known function is to regulate iron absorption by interacting with transferrin and its receptor. 
 +
 
 +
=DNA Sequence=
 +
''HFE'' is located on chromosome 6 in humans. 
 +
 
 +
=RNA Sequence=
 +
There are several alternatively spliced variants of ''HFE''. 
 +
 
 +
=Protein Sequence=
 +
The protein has a signal sequence and transmembrane domain.  It forms a tertiary complex with beta2-microglobulin (beta2M).  ''HFE'' has sequence and structural similarity to MHC class I-type proteins.   
  
 
NCBI Protein[http://www.ncbi.nlm.nih.gov/protein/NP_000401]
 
NCBI Protein[http://www.ncbi.nlm.nih.gov/protein/NP_000401]
Line 9: Line 18:
 
KVTHHVTSSVTTLRCRALNYYPQNITMKWLKDKQPMDAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRY
 
KVTHHVTSSVTTLRCRALNYYPQNITMKWLKDKQPMDAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRY
 
TCQVEHPGLDQPLIVIWEPSPSGTLVIGVISGIAVFVVILFIGILFIILRKRQGSRGAMGHYVLAERE</pre>
 
TCQVEHPGLDQPLIVIWEPSPSGTLVIGVISGIAVFVVILFIGILFIILRKRQGSRGAMGHYVLAERE</pre>
 
  
 
NCBI Structure[http://www.ncbi.nlm.nih.gov/structure?Db=structure&DbFrom=protein&Cmd=Link&LinkName=protein_structure&LinkReadableName=Structure&IdsFromResult=4504377]
 
NCBI Structure[http://www.ncbi.nlm.nih.gov/structure?Db=structure&DbFrom=protein&Cmd=Link&LinkName=protein_structure&LinkReadableName=Structure&IdsFromResult=4504377]

Revision as of 09:23, 18 July 2014

HFE is named after High Fe (iron). The gene products known function is to regulate iron absorption by interacting with transferrin and its receptor.

DNA Sequence

HFE is located on chromosome 6 in humans.

RNA Sequence

There are several alternatively spliced variants of HFE.

Protein Sequence

The protein has a signal sequence and transmembrane domain. It forms a tertiary complex with beta2-microglobulin (beta2M). HFE has sequence and structural similarity to MHC class I-type proteins.

NCBI Protein[1]

>gi|4504377|ref|NP_000401.1| hereditary hemochromatosis protein isoform 1 precursor [Homo sapiens]
MGPRARPALLLLMLLQTAVLQGRLLRSHSLHYLFMGASEQDLGLSLFEALGYVDDQLFVFYDHESRRVEP
RTPWVSSRISSQMWLQLSQSLKGWDHMFTVDFWTIMENHNHSKESHTLQVILGCEMQEDNSTEGYWKYGY
DGQDHLEFCPDTLDWRAAEPRAWPTKLEWERHKIRARQNRAYLERDCPAQLQQLLELGRGVLDQQVPPLV
KVTHHVTSSVTTLRCRALNYYPQNITMKWLKDKQPMDAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRY
TCQVEHPGLDQPLIVIWEPSPSGTLVIGVISGIAVFVVILFIGILFIILRKRQGSRGAMGHYVLAERE

NCBI Structure[2]

UniProt protein accession: Q30201

Plot in Protter[3]

HFE protter.png