Difference between revisions of "HFE"
(→Protein Sequence) |
(→Protein Sequence) |
||
| Line 21: | Line 21: | ||
NCBI Structure[http://www.ncbi.nlm.nih.gov/structure?Db=structure&DbFrom=protein&Cmd=Link&LinkName=protein_structure&LinkReadableName=Structure&IdsFromResult=4504377] | NCBI Structure[http://www.ncbi.nlm.nih.gov/structure?Db=structure&DbFrom=protein&Cmd=Link&LinkName=protein_structure&LinkReadableName=Structure&IdsFromResult=4504377] | ||
| − | HFE (magenta) tertiary complex with beta2M (blue) | + | HFE (magenta) tertiary complex with beta2M (blue)<ref>Lebron, J. A., Bennett, M. J., Vaughn, D. E., Chirino, A. J., Snow, P. M., Mintier, G. A., ... & Bjorkman, P. J. (1998). Crystal structure of the hemochromatosis protein HFE and characterization of its interaction with transferrin receptor. Cell, 93(1), 111-123.</ref> |
[[File:HFE-beta2M-2.png|300px]] | [[File:HFE-beta2M-2.png|300px]] | ||
Revision as of 10:11, 18 July 2014
HFE is named after High Fe (iron). The gene products known function is to regulate iron absorption by interacting with the transferrin receptor (TfR). When the normal function is disrupted by mutation the result can be HFE hereditary hemochromatosis or iron overload.
DNA Sequence
HFE is located on chromosome 6 in humans.
RNA Sequence
There are several alternatively spliced variants of HFE.
Protein Sequence
The protein has a signal sequence and transmembrane domain. It forms a tertiary complex with beta2-microglobulin (beta2M) and TfR. HFE has sequence and structural similarity to MHC class I-type proteins.
NCBI Protein[1]
>gi|4504377|ref|NP_000401.1| hereditary hemochromatosis protein isoform 1 precursor [Homo sapiens] MGPRARPALLLLMLLQTAVLQGRLLRSHSLHYLFMGASEQDLGLSLFEALGYVDDQLFVFYDHESRRVEP RTPWVSSRISSQMWLQLSQSLKGWDHMFTVDFWTIMENHNHSKESHTLQVILGCEMQEDNSTEGYWKYGY DGQDHLEFCPDTLDWRAAEPRAWPTKLEWERHKIRARQNRAYLERDCPAQLQQLLELGRGVLDQQVPPLV KVTHHVTSSVTTLRCRALNYYPQNITMKWLKDKQPMDAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRY TCQVEHPGLDQPLIVIWEPSPSGTLVIGVISGIAVFVVILFIGILFIILRKRQGSRGAMGHYVLAERE
NCBI Structure[2]
HFE (magenta) tertiary complex with beta2M (blue)[1]
HFE (magenta and green) tertiary complex with beta2M (blue and gray) and TfR (yellow and brown)[2]
Plot in Protter[3] with UniProt accession: Q30201
- ↑ Lebron, J. A., Bennett, M. J., Vaughn, D. E., Chirino, A. J., Snow, P. M., Mintier, G. A., ... & Bjorkman, P. J. (1998). Crystal structure of the hemochromatosis protein HFE and characterization of its interaction with transferrin receptor. Cell, 93(1), 111-123.
- ↑ Bennett, M. J., Lebrón, J. A., & Bjorkman, P. J. (2000). Crystal structure of the hereditary haemochromatosis protein HFE complexed with transferrin receptor. Nature, 403(6765), 46-53.
