RFP

From Genetics Wiki
Revision as of 11:10, 14 July 2014 by Floyd (Talk | contribs)

Jump to: navigation, search

Red Fluorescent Protein


Protein sequence in FASTA format from uniprot[1].

>sp|Q9U6Y8|RFP_DISSP Red fluorescent protein drFP583 OS=Discosoma sp. PE=1 SV=1
MRSSKNVIKEFMRFKVRMEGTVNGHEFEIEGEGEGRPYEGHNTVKLKVTKGGPLPFAWDI
LSPQFQYGSKVYVKHPADIPDYKKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGCFIY
KVKFIGVNFPSDGPVMQKKTMGWEASTERLYPRDGVLKGEIHKALKLKDGGHYLVEFKSI
YMAKKPVQLPGYYYVDSKLDITSHNEDYTIVEQYERTEGRHHLFL

Matz, M. V., Fradkov, A. F., Labas, Y. A., Savitsky, A. P., Zaraisky, A. G., Markelov, M. L., & Lukyanov, S. A. (1999). Fluorescent proteins from nonbioluminescent Anthozoa species. Nature biotechnology, 17(10), 969-973.[2]

Baird, G. S., Zacharias, D. A., & Tsien, R. Y. (2000). Biochemistry, mutagenesis, and oligomerization of DsRed, a red fluorescent protein from coral. Proceedings of the National Academy of Sciences, 97(22), 11984-11989.[3]

Shaner, N. C., Campbell, R. E., Steinbach, P. A., Giepmans, B. N., Palmer, A. E., & Tsien, R. Y. (2004). Improved monomeric red, orange and yellow fluorescent proteins derived from Discosoma sp. red fluorescent protein. Nature biotechnology, 22(12), 1567-1572.

Campbell, R. E., Tour, O., Palmer, A. E., Steinbach, P. A., Baird, G. S., Zacharias, D. A., & Tsien, R. Y. (2002). A monomeric red fluorescent protein. Proceedings of the National Academy of Sciences, 99(12), 7877-7882.

Bevis, B. J., & Glick, B. S. (2002). Rapidly maturing variants of the Discosoma red fluorescent protein (DsRed). Nature biotechnology, 20(1), 83-87.

Merzlyak, E. M., Goedhart, J., Shcherbo, D., Bulina, M. E., Shcheglov, A. S., Fradkov, A. F., ... & Chudakov, D. M. (2007). Bright monomeric red fluorescent protein with an extended fluorescence lifetime. Nature methods, 4(7), 555-557.

Yarbrough, D., Wachter, R. M., Kallio, K., Matz, M. V., & Remington, S. J. (2001). Refined crystal structure of DsRed, a red fluorescent protein from coral, at 2.0-Å resolution. Proceedings of the National Academy of Sciences, 98(2), 462-467.

Shcherbo, D., Merzlyak, E. M., Chepurnykh, T. V., Fradkov, A. F., Ermakova, G. V., Solovieva, E. A., ... & Chudakov, D. M. (2007). Bright far-red fluorescent protein for whole-body imaging. Nature methods, 4(9), 741-746.

Vintersten, K., Monetti, C., Gertsenstein, M., Zhang, P., Laszlo, L., Biechele, S., & Nagy, A. (2004). Mouse in red: red fluorescent protein expression in mouse ES cells, embryos, and adult animals. genesis, 40(4), 241-246.

Kukar, T., Eckenrode, S., Gu, Y., Lian, W., Megginson, M., She, J. X., & Wu, D. (2002). Protein microarrays to detect protein–protein interactions using red and green fluorescent proteins. Analytical biochemistry, 306(1), 50-54.

[4]